Gene CC1G_07435 (C.cinerea)

CC1G_07435

Species: C.cinerea
Alias: CC1G_07435
External Links:
Annotation:

Classification

Group: Other
Family: FunK1

Sequence

Name Sequence Type Origin Length Description Download
CC1G_07435.AA Protein None 940 None Fasta, JSON
CC1G_07435.NA RNA None 2823 None Fasta, JSON
CC1G_07435.kin_dom Protein Kinase Domain None 481 None Fasta, JSON

Protein domain

Protein domains of CC1G_07435.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase CC1G_07435.AA TAO 623-666 45 0.000496 8.74 In-house 104-142 (254) Show / Hide 
Range on Protein: 623-666
Range on HMM: 104-142/254
Sequence Identity: 45% (20 aa)

IIKGCLTVLRVMFCAGWVHRDISAGNILAARGRPRGPWQVKLAD
| .| |  || .     .|||| ||||| .      . ||||||
ICHGALQGLRYLHSHKMIHRDIKAGNILLTE-----HGQVKLAD