Gene CC1G_09363 (C.cinerea)

CC1G_09363

Species: C.cinerea
Alias: CC1G_09363
External Links:
Annotation:

Classification

Group: Other
Family: FunK1

Sequence

Name Sequence Type Origin Length Description Download
CC1G_09363.AA Protein None 805 None Fasta, JSON
CC1G_09363.NA RNA None 2418 None Fasta, JSON
CC1G_09363.kin_dom Protein Kinase Domain None 469 None Fasta, JSON

Protein domain

Protein domains of CC1G_09363.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase CC1G_09363.AA TKL 505-562 24 0.000206 11.81 In-house 162-244 (364) Show / Hide 
Range on Protein: 505-562
Range on HMM: 162-244/364
Sequence Identity: 24% (20 aa)

VHRDISTGNILAHRS---------SPGTPWQVKLSDLEYAKRFP--GNPTATASTEV--------------KTGTMYFMAVEV
.|||. . ||| ..          .|  .| .|..|.  ....   || ..|..|.               . || ..|| ||
IHRDLKSKNILVDENWTNVSNYMYNPNADWCCKICDFGLSRFMSQSGNMNDTMTTMMESAEHQNNRKTTMTQCGTPRWMAPEV