Gene CC1G_07436 (C.cinerea)

CC1G_07436

Species: C.cinerea
Alias: CC1G_07436
External Links:
Annotation:

Classification

Group: Other
Family: FunK1

Sequence

Name Sequence Type Origin Length Description Download
CC1G_07436.AA Protein None 501 None Fasta, JSON
CC1G_07436.NA RNA None 1506 None Fasta, JSON
CC1G_07436.kin_dom Protein Kinase Domain None 430 None Fasta, JSON

Protein domain

Protein domains of CC1G_07436.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase CC1G_07436.AA Ciliate-E2 253-311 20 0.000113 11.94 In-house 183-261 (365) Show / Hide 
Range on Protein: 253-311
Range on HMM: 183-261/365
Sequence Identity: 20% (18 aa)

VHRDVSIGNILASRPSTGTPWEVKLADLEHARKFPDPNI---------LSDDCP----------------------IGTPHFMAVEVQKG
.|||    |||           .|..|.  ..|. |.|.         .  .                        .|||..|| |. .|
IHRDIKPENILF----------IKIIDFGLSKKYDDDNQNRTHKQQCKWYMF-KNDTSRTPGYMDQIIQQNMFNTICGTPGYMAPEILNG
Kinase CC1G_07436.AA TAO 242-308 35 0.000167 10.31 In-house 110-166 (254) Show / Hide 
Range on Protein: 242-308
Range on HMM: 110-166/254
Sequence Identity: 35% (24 aa)

QSLRLMWCAGWVHRDVSIGNILASRPSTGTPWEVKLADLEHARKFPDPNILSDDCPIGTPHFMAVEV
|.|| .     .|||.  |||| . ...     |||||   |      |       .|||..|| ||
QGLRYLHSHKMIHRDIKAGNILLTEHGQ-----VKLADFGSASMVCPANSF-----VGTPYWMAPEV
Kinase CC1G_07436.AA CRIK 251-308 44 0.000335 8.9 In-house 120-172 (272) Show / Hide 
Range on Protein: 251-308
Range on HMM: 120-172/272
Sequence Identity: 44% (26 aa)

GWVHRDVSIGNILASRPSTGTPWEVKLADLEHARKFPDPNILSDDCPIGTPHFMAVEV
| ||||.   |||  |  ||    .||||   | |  . |  .   |.||| .|| ||
GYVHRDIKPENILIDR--TG---HIKLADFGSAAKMNRNNHVNSKMPVGTPDYMAPEV