Gene CC1G_12692 (C.cinerea)
CC1G_12692
Species: C.cinerea
Alias: CC1G_12692
External Links:
Annotation:
Sequence
Name | Sequence Type | Origin | Length | Description | Download |
---|---|---|---|---|---|
CC1G_12692.AA | Protein | None | 564 | None | Fasta, JSON |
CC1G_12692.NA | RNA | None | 1695 | None | Fasta, JSON |
CC1G_12692.kin_dom | Protein Kinase Domain | None | 423 | None | Fasta, JSON |
Protein domains of CC1G_12692.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
---|---|---|---|---|---|---|---|---|---|
Kinase | CC1G_12692.AA | TTBKL | 244-267 | 54 | 2e-06 | 17.77 | In-house | 110-133 (288) | Show / Hide |
Range on Protein: 244-267 Range on HMM: 110-133/288 Sequence Identity: 54% (13 aa) QCLTALRLMFCAGWVHRDVSPGNI ||| ||..| .|..|||| |.|. QCLYALKQMHDCGFIHRDVKPCNC |
|||||||||
Kinase | CC1G_12692.AA | CK1 | 234-268 | 34 | 1.4e-05 | 15.56 | In-house | 130-164 (339) | Show / Hide |
Range on Protein: 234-268 Range on HMM: 130-164/339 Sequence Identity: 34% (12 aa) TLGEVFDIVKQCLTALRLMFCAGWVHRDVSPGNIL ... .. | |.| ||. | .|..|||. |.|.. SMKTWLMIAIQMLEALEYMHDCGFIHRDIKPDNFC |
|||||||||
Kinase | CC1G_12692.AA | CAMK | 258-318 | 18 | 1.9e-05 | 12.75 | In-house | 201-310 (425) | Show / Hide |
Range on Protein: 258-318 Range on HMM: 201-310/425 Sequence Identity: 18% (20 aa) VHRDVSPGNILAVRQTPGSP------------WRVQLSDLEFARRFPDVG----------------------APPSSQITGTPPFMA-CEIHTS------ |||| | ||| . ..|. . . ..| ||..|.. .. . |||..|| |. . VHRDLKPENILLDDNNDDSDPVEHDEIFDWNNNNIKIIDFGFANKFDPGENNFMCSDYKGGEMHNQWTTPTEGQKMKTFCGTPEYMAAPEVLNGKGHCNM --------KY .| QNATDEEKPY |