Gene CC1G_12692 (C.cinerea)

CC1G_12692

Species: C.cinerea
Alias: CC1G_12692
External Links:
Annotation:

Classification

Group: Other
Family: FunK1

Sequence

Name Sequence Type Origin Length Description Download
CC1G_12692.AA Protein None 564 None Fasta, JSON
CC1G_12692.NA RNA None 1695 None Fasta, JSON
CC1G_12692.kin_dom Protein Kinase Domain None 423 None Fasta, JSON

Protein domain

Protein domains of CC1G_12692.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase CC1G_12692.AA TTBKL 244-267 54 2e-06 17.77 In-house 110-133 (288) Show / Hide 
Range on Protein: 244-267
Range on HMM: 110-133/288
Sequence Identity: 54% (13 aa)

QCLTALRLMFCAGWVHRDVSPGNI
||| ||..|  .|..|||| |.|.
QCLYALKQMHDCGFIHRDVKPCNC
Kinase CC1G_12692.AA CK1 234-268 34 1.4e-05 15.56 In-house 130-164 (339) Show / Hide 
Range on Protein: 234-268
Range on HMM: 130-164/339
Sequence Identity: 34% (12 aa)

TLGEVFDIVKQCLTALRLMFCAGWVHRDVSPGNIL
... .. |  |.| ||. |  .|..|||. |.|..
SMKTWLMIAIQMLEALEYMHDCGFIHRDIKPDNFC
Kinase CC1G_12692.AA CAMK 258-318 18 1.9e-05 12.75 In-house 201-310 (425) Show / Hide 
Range on Protein: 258-318
Range on HMM: 201-310/425
Sequence Identity: 18% (20 aa)

VHRDVSPGNILAVRQTPGSP------------WRVQLSDLEFARRFPDVG----------------------APPSSQITGTPPFMA-CEIHTS------
||||  | ||| .   ..|.            . . ..|  ||..|..                         .. .   |||..||  |.  .      
VHRDLKPENILLDDNNDDSDPVEHDEIFDWNNNNIKIIDFGFANKFDPGENNFMCSDYKGGEMHNQWTTPTEGQKMKTFCGTPEYMAAPEVLNGKGHCNM

--------KY
        .|
QNATDEEKPY