CC1G_07011

Species: C.cinerea
Alias: CC1G_07011
External Links:
Annotation:

Classification

Group: Other
Family: FunK1

Sequence

Name Sequence Type Origin Length Description Download
CC1G_07011.AA Protein None 935 None Fasta, JSON
CC1G_07011.NA RNA None 2808 None Fasta, JSON
CC1G_07011.kin_dom Protein Kinase Domain None 478 None Fasta, JSON

Protein domain

Protein domains of CC1G_07011.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase CC1G_07011.AA SLK 539-613 32 4.5e-05 12.93 In-house 102-168 (259) Show / Hide
Range on Protein: 539-613
Range on HMM: 102-168/259
Sequence Identity: 32% (24 aa)

VLKQCLDVLRLIFCAGWVHRDISAGNILAWWDGSKKKWQVKLSDLKYAKKFPGKKGRMSSGIPKTGTPFFMAVEI
| |. .. |. .     .|||. |||||   ||     .|.| |   . |   .  .  . |   |||..|| |.
VCKHMCEALNWLHSNKVIHRDLKAGNILMTMDG-----DVRLADFGVSAKNKHTMQKRDTFI---GTPYWMAPEV

Kinase CC1G_07011.AA CK1 542-566 36 0.000274 10.96 In-house 140-164 (339) Show / Hide
Range on Protein: 542-566
Range on HMM: 140-164/339
Sequence Identity: 36% (9 aa)

QCLDVLRLIFCAGWVHRDISAGNIL
|.|..|. .  .|..|||| ..|..
QMLEALEYMHDCGFIHRDIKPDNFC

Kinase CC1G_07011.AA TAO 539-613 33 0.00061 8.44 In-house 104-166 (254) Show / Hide
Range on Protein: 539-613
Range on HMM: 104-166/254
Sequence Identity: 33% (25 aa)

VLKQCLDVLRLIFCAGWVHRDISAGNILAWWDGSKKKWQVKLSDLKYAKKFPGKKGRMSSGIPKTGTPFFMAVEI
. .. |. || .     .|||| |||||   .|     ||||.|        |    ..      |||..|| |.
ICHGALQGLRYLHSHKMIHRDIKAGNILLTEHG-----QVKLADF-------GSASMVCPANSFVGTPYWMAPEV

Kinase CC1G_07011.AA TKL 556-613 18 0.000859 9.55 In-house 162-244 (364) Show / Hide
Range on Protein: 556-613
Range on HMM: 162-244/364
Sequence Identity: 18% (15 aa)

VHRDISAGNILAWWDGS---------KKKWQVKLSDLKYAK-KFPGKKGRMSS---------------GIPKTGTPFFMAVEI
.|||.   ||| . ..          .. | .|..|.  .. ... ..  ...                ... ||| .|| |.
IHRDLKSKNILVDENWTNVSNYMYNPNADWCCKICDFGLSRFMSQSGNMNDTMTTMMESAEHQNNRKTTMTQCGTPRWMAPEV