Gene DDB0230125 (Slime mold)
DDB0230125
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| DDB0230125.AA | Protein | None | 647 | None | Fasta, JSON |
| DDB0230125.kin_dom | Protein Kinase Domain | None | 100 | None | Fasta, JSON |
Protein domains of DDB0230125.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | DDB0230125.AA | Dicty10 | 366-505 | 95 | 4.5e-133 | 389.89 | In-house | 1-140 (140) | Show / Hide |
Range on Protein: 366-505 Range on HMM: 1-140/140 Sequence Identity: 95% (133 aa) VYKWFNYPYFFQTEVKYLTFIDGIEGTPSIKQQNQTENWIQISPRGQLIKNLEGKPIDISFYTKVFCRNTQKHTSREVIHRDIRLSNLLMDSGGDPLLVD ||||||.| ||.||||||||||||||||.||||||||||||||||||||||||||||||||||||||||.|||.|||||||||||||||||||||||||| VYKWFNHPNFFKTEVKYLTFIDGIEGTPTIKQQNQTENWIQISPRGQLIKNLEGKPIDISFYTKVFCRNKQKHQSREVIHRDIRLSNLLMDSGGDPLLVD FGFANFTENEEFYQGTMNTASNRIYNILINNRTNHAFSVV ||||||||||||||||||||||||||||||||||||||| FGFANFTENEEFYQGTMNTASNRIYNILINNRTNHAFSVD |
|||||||||
| Kinase | DDB0230125.AA | MARK | 440-470 | 39 | 1.9e-07 | 20.56 | In-house | 122-154 (262) | Show / Hide |
Range on Protein: 440-470 Range on HMM: 122-154/262 Sequence Identity: 39% (13 aa) SREVIHRDIRLSNLLMDSGG--DPLLVDFGFAN |. ..|||| . |.|.|. | . . ||||.. SKNIVHRDIKPENILIDENGNHNIKIIDFGFSI |
|||||||||
| Kinase | DDB0230125.AA | Ciliate-E2-Unclassified | 443-469 | 40 | 2.6e-07 | 21.46 | In-house | 165-194 (352) | Show / Hide |
Range on Protein: 443-469 Range on HMM: 165-194/352 Sequence Identity: 40% (12 aa) VIHRDIRLSNLLMDSGG---DPLLVDFGFA .||||| ..|.|.|..| . . |||.. IIHRDIKPENILFDNNGKNYYIKIIDFGIS |
|||||||||
| Kinase | DDB0230125.AA | CAMKL | 440-471 | 41 | 1e-06 | 17.18 | In-house | 145-178 (297) | Show / Hide |
Range on Protein: 440-471 Range on HMM: 145-178/297 Sequence Identity: 41% (14 aa) SREVIHRDIRLSNLLMDSGGD--PLLVDFGFANF |. ..|||| . |.| |. |. ..||||.|. SHGIVHRDIKPENILLDENGNNNIKIIDFGFSNM |
|||||||||
| Kinase | DDB0230125.AA | AGC | 443-469 | 42 | 1e-06 | 11.42 | In-house | 175-202 (395) | Show / Hide |
Range on Protein: 443-469 Range on HMM: 175-202/395 Sequence Identity: 42% (12 aa) VIHRD-IRLSNLLMDSGGDPLLVDFGFA .|||| . . |.|.|. | |.|||.. IIHRDYLKPENILLDEDGHIKLTDFGLC |
|||||||||
| Kinase | DDB0230125.AA | QIK | 440-476 | 32 | 2e-06 | 21.68 | In-house | 136-172 (272) | Show / Hide |
Range on Protein: 440-476 Range on HMM: 136-172/272 Sequence Identity: 32% (12 aa) SREVIHRDIRLSNLLMDSGGDPLLVDFGFANFTENEE .|...|||. |.|.|. . ..|||| |. .... KRNIVHRDLKAENILLDNNMNIKIADFGFSNWFKQGQ |
|||||||||
| Kinase | DDB0230125.AA | Ciliate-E2 | 440-469 | 35 | 3e-06 | 17.68 | In-house | 178-203 (365) | Show / Hide |
Range on Protein: 440-469 Range on HMM: 178-203/365 Sequence Identity: 35% (11 aa) SRE-VIHRDIRLSNLLMDSGGDPLLVDFGFA |. .||||| ..|.|. . ..|||.. SKNNIIHRDIKPENILF-----IKIIDFGLS |
|||||||||
| Kinase | DDB0230125.AA | NuaK | 442-479 | 31 | 4e-06 | 11.61 | In-house | 119-156 (252) | Show / Hide |
Range on Protein: 442-479 Range on HMM: 119-156/252 Sequence Identity: 31% (12 aa) EVIHRDIRLSNLLMDSGGDPLLVDFGFANFTENEEFYQ ...||| .| | |.| .. ||| |. ....| . RICHRDLKLENILLDQNCNAKIADFGLSNYYHDQKFLH |
|||||||||
| Kinase | DDB0230125.AA | CMGC | 440-475 | 18 | 1.4e-05 | 13.29 | In-house | 200-257 (513) | Show / Hide |
Range on Protein: 440-475 Range on HMM: 200-257/513 Sequence Identity: 18% (11 aa) SRE--VIHRDIRLSNLLMDSGGDP--------------------LLVDFGFANFTENE |. .||||. .|.|... .. . |||.| ..... SHWGNIIHRDLKPENILINHNCELITRMMWKSEDWNPCQKNGRLKICDFGLARWYHPH |
|||||||||
| Kinase | DDB0230125.AA | Aur | 440-476 | 36 | 1.6e-05 | 9.97 | In-house | 119-156 (257) | Show / Hide |
Range on Protein: 440-476 Range on HMM: 119-156/257 Sequence Identity: 36% (14 aa) SREVIHRDIRLSNLLMD-SGGDPLLVDFGFANFTENEE |. .||||| |.|.| . |. . ||| .... |.. SKNIIHRDIKPENILLDQCNGNIKICDFGWSVHCPNNN |
|||||||||
| Kinase | DDB0230125.AA | APH | 443-469 | 22 | 0.000113 | 16.82 | Pfam | 172-202 (248) | Show / Hide |
Range on Protein: 443-469 Range on HMM: 172-202/248 Sequence Identity: 22% (7 aa) VIHRDIRLSNLLMD--SGGDPL--LVDFGFA ..|.| .. |...| ..|... ..|...| WCHGDFHPGNVMWDPRPDGGRVTGVIDWDDA |
|||||||||
| Kinase | DDB0230125.AA | Pkinase | 440-480 | 29 | 0.000894 | 14.43 | Pfam | 126-170 (293) | Show / Hide |
Range on Protein: 440-480 Range on HMM: 126-170/293 Sequence Identity: 29% (14 aa) SREVIHRDIRLSNLLMDSGGDP----LLVDFGFANF--TENEEFYQG |. .||||. ..|.|.|. |.. . |||.| . . | . ... SMGIIHRDLKPENILIDNNGHIDACVKICDFGLAKQFDY-NNS-MTT |
|||||||||