Gene GL50803_95557 (G.lamblia)
GL50803_95557
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| GL50803_95557.AA | Protein | None | 801 | None | Fasta, JSON |
| GL50803_95557.kin_dom | Protein Kinase Domain | None | 248 | None | Fasta, JSON |
Protein domains of GL50803_95557.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | GL50803_95557.AA | WEE | 320-365 | 29 | 1.1e-08 | 25.35 | In-house | 251-297 (297) | Show / Hide |
Range on Protein: 320-365 Range on HMM: 251-297/297 Sequence Identity: 29% (14 aa) SLDKEYYT-KGLDKEYGADLAILLRSMMQTNYRKRPTLSYILNLPLL |.||.. .| .....| |...||. ....||| . .|. |.| SFDKNQIPFPEFDNIISQELKQLIKWMMHPDPEQRPTCQQLLQHPVL |
|||||||||
| Kinase | GL50803_95557.AA | NEK | 334-365 | 34 | 6e-06 | 17.5 | In-house | 255-286 (286) | Show / Hide |
Range on Protein: 334-365 Range on HMM: 255-286/286 Sequence Identity: 34% (11 aa) YGADLAILLRSMMQTNYRKRPTLSYILNLPLL | || |...| | . .||. . ||..|.. YSQDLQNLISQMLQKDPEQRPSCNQILEMPFI |
|||||||||
| Kinase | GL50803_95557.AA | NEK8 | 330-365 | 25 | 3.4e-05 | 10.63 | In-house | 243-278 (278) | Show / Hide |
Range on Protein: 330-365 Range on HMM: 243-278/278 Sequence Identity: 25% (9 aa) LDKEYGADLAILLRSMMQTNYRKRPTLSYILNLPLL .. | ... | .. |. .||..| |. ||. ISDHYSNEMRMLVHNCLQQDPEQRPSASQIMAMPLC |
|||||||||
| Kinase | GL50803_95557.AA | CAMKL | 337-365 | 44 | 4.3e-05 | 12.03 | In-house | 269-297 (297) | Show / Hide |
Range on Protein: 337-365 Range on HMM: 269-297/297 Sequence Identity: 44% (13 aa) DLAILLRSMMQTNYRKRPTLSYILNLPLL |. |.|.|.|.| ||||. |.| | . DCRDLIRKMLQVNPEKRPTIHQIMNHPWM |
|||||||||
| S_TKc | GL50803_95557.AA | S_TKc | 16-365 | 12 | 0.000205 | -112.18 | SMART | 1-231 (231) | Show / Hide |
Range on Protein: 16-365
Range on HMM: 1-231/231
Sequence Identity: 12% (46 aa)
WEETTMVRQCTNSRVLCCYKLEDNE------VDDDEKAHLKTRLDLLLTVRHQ---GMRLIYEPTSPPYLFYAYCGG--GSLQDAFKSHILQETK--FSR
.| . . . ..| .|.. .... .. |.. ...| .| . ... . |.. ||.| |.| | |.. . .. |.
YEILRKIGKGAFGKVYKCRHKKTGRIVAIKIIK----EHIRREIQILKK-HHPNIVKLYDVFQD-DHLYMVMEYCDGDLGDLFDYIKKRGRHGLRFPFPE
DEILDMLYQLASLCIFLYESQTGIL-----DENSIIIDPRCIFYDDYGMLRVEFGCPMFKMVHVKKKFTSTADAGDVVMMTSLPLPDLFYDMSGAIDPES
.. ..||... .. . ||. || | .| .| | |. |.
-HARFYMYQICCALEYCHSH--GIIHRDLKPEN-ILLDE-HIKICDFGLARQL-----------------------------------------------
MMGANIFNRRDNFSDIASDTSASVSEVAMADSSTNAITNSEHNSSVQSNTQSNAKASKYLHDPLTPYRRQPLNTDICHHDRYVPPEYYNQQQDTP-EGVV
| .| |..|| . .. . .
-------------------------------------------------------------------------TTFCGTPWYMAPEVL---GYGKCKCDW
WSIGRLLYDACQLTGSIHKTALSSLDKEYYTKGLDKEYGADLAILLRSMMQTNYRKRPTLSYILN-------LPLL
||.| .|| . . ... . | . .. ..| ..| . .|||| .|. | .
WSCGCILYEMLCGYPPFP------QMQMMFKKIG----SPEAKDFIRKCLQKDPEKRPTA-EALQDEWDIKCHPWF
|
|||||||||
| Kinase | GL50803_95557.AA | NEK-Unclassified | 332-365 | 29 | 0.000218 | 10.1 | In-house | 225-258 (258) | Show / Hide |
Range on Protein: 332-365 Range on HMM: 225-258/258 Sequence Identity: 29% (10 aa) KEYGADLAILLRSMMQTNYRKRPTLSYILNLPLL | | .|| ..| |.. |. .|| |. .. KTYSTDLQQVIRFMLRRNFQQRPSATEIVEQDYI |
|||||||||
| Kinase | GL50803_95557.AA | CAMK | 341-365 | 40 | 0.000434 | 8.28 | In-house | 401-425 (425) | Show / Hide |
Range on Protein: 341-365 Range on HMM: 401-425/425 Sequence Identity: 40% (10 aa) LLRSMMQTNYRKRPTLSYILNLPLL |.|.|.|.. ||.|.. .|| | . LIRKMLQVDPEKRMTIEQCLNHPWM |
|||||||||
| Kinase | GL50803_95557.AA | NEK | 80-114 | 29 | 0.002386 | 8.11 | In-house | 87-125 (286) | Show / Hide |
Range on Protein: 80-114 Range on HMM: 87-125/286 Sequence Identity: 29% (12 aa) YCG-GGSLQDAFKSHILQETK-----FSRDEILDMLYQLAS || || |.. .|| ... | |. ..|.|...|... YCEGGGDLYQKIKS--IKKQKQKGKYFEEEQIWDWFIQMCL |
|||||||||
| Kinase | GL50803_95557.AA | WEE | 80-113 | 25 | 0.236734 | 0.38 | In-house | 86-121 (297) | Show / Hide |
Range on Protein: 80-113 Range on HMM: 86-121/297 Sequence Identity: 25% (9 aa) YCGGGS--LQDAFKSHILQETKFSRDEILDMLYQLA || ||| ||....... ... ..| . | ... YCNGGSNLLQFWIQQCHNWNHWLPEWMIWQILVDIC |
|||||||||
| Ank | GL50803_95557.AA | Ank | 383-401 | 36 | 10.733027 | 3.16 | Pfam | 1-19 (33) | Show / Hide |
Range on Protein: 383-401 Range on HMM: 1-19/33 Sequence Identity: 36% (7 aa) DGNTQLMIAAAEGDIASVR ||.| |..|. |.. |. DGFTPLHLACRCGHTEVVK |
|||||||||
| Ank | GL50803_95557.AA | Ank | 413-428 | 37 | 0.242086 | 9.1 | Pfam | 1-16 (33) | Show / Hide |
Range on Protein: 413-428 Range on HMM: 1-16/33 Sequence Identity: 37% (6 aa) RGETALMLALKHGQED |.|.|.|| ..|... DGFTPLHLACRCGHTE |
|||||||||
| Ank | GL50803_95557.AA | Ank | 507-527 | 38 | 0.388278 | 8.36 | Pfam | 1-21 (33) | Show / Hide |
Range on Protein: 507-527 Range on HMM: 1-21/33 Sequence Identity: 38% (8 aa) PGTTALMMAASVGSTGCVEQL | |.|..|.. |.| .|. | DGFTPLHLACRCGHTEVVKML |
|||||||||
| Ank | GL50803_95557.AA | Ank | 538-564 | 37 | 0.003425 | 15.77 | Pfam | 1-27 (33) | Show / Hide |
Range on Protein: 538-564 Range on HMM: 1-27/33 Sequence Identity: 37% (10 aa) KGMTAMMHAVLRGQTDVVCFLSQYEAN |.|. . |...|.|.|| .| |. |. DGFTPLHLACRCGHTEVVKMLLQHGAD |
|||||||||
| Ank | GL50803_95557.AA | Ank | 628-651 | 33 | 0.003866 | 15.58 | Pfam | 1-24 (33) | Show / Hide |
Range on Protein: 628-651 Range on HMM: 1-24/33 Sequence Identity: 33% (8 aa) GGYSALMLAAQYGNIRAVESLLKY |...|.||...|... |. ||.. DGFTPLHLACRCGHTEVVKMLLQH |
|||||||||
| Ank | GL50803_95557.AA | Ank | 659-680 | 54 | 0.000284 | 19.67 | Pfam | 1-22 (33) | Show / Hide |
Range on Protein: 659-680 Range on HMM: 1-22/33 Sequence Identity: 54% (12 aa) DGTTALMLAIRYGYTSVAKVLV || |.|.||.|.|.|.|.| |. DGFTPLHLACRCGHTEVVKMLL |
|||||||||
| Ank | GL50803_95557.AA | Ank | 696-716 | 42 | 0.009512 | 14.17 | Pfam | 1-21 (33) | Show / Hide |
Range on Protein: 696-716 Range on HMM: 1-21/33 Sequence Identity: 42% (9 aa) DKYTALMEAAVCGDLEIVNAL | .|.|. |. ||..|.| | DGFTPLHLACRCGHTEVVKML |
|||||||||