Gene GL50803_88735 (G.lamblia)
GL50803_88735
Sequence
Name | Sequence Type | Origin | Length | Description | Download |
---|---|---|---|---|---|
GL50803_88735.AA | Protein | None | 654 | None | Fasta, JSON |
GL50803_88735.kin_dom | Protein Kinase Domain | None | 258 | None | Fasta, JSON |
Protein domains of GL50803_88735.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
---|---|---|---|---|---|---|---|---|---|
Kinase | GL50803_88735.AA | NEK | 94-145 | 24 | 4e-06 | 17.88 | In-house | 70-127 (286) | Show / Hide |
Range on Protein: 94-145 Range on HMM: 70-127/286 Sequence Identity: 24% (14 aa) YRCYLEND--YLIVEQGLAS-TRSLSQY---IRRHKNSGVSFHESVLWKVASQLLKAL | ...|.. .|. . . |.| | ..|..| | |.. |.. |...|| YDSFIEEQNNCLCIVMEYCEGGGDLYQKIKSIKKQKQKGKYFEEEQIWDWFIQMCLAL |
|||||||||
Ank | GL50803_88735.AA | Ank | 320-340 | 28 | 0.432789 | 8.19 | Pfam | 1-21 (33) | Show / Hide |
Range on Protein: 320-340 Range on HMM: 1-21/33 Sequence Identity: 28% (6 aa) LGETALDLAAAHNNATIMALL |.|.| ||. .... .. .| DGFTPLHLACRCGHTEVVKML |
|||||||||
Ank | GL50803_88735.AA | Ank | 457-475 | 36 | 7.179782 | 3.79 | Pfam | 1-19 (33) | Show / Hide |
Range on Protein: 457-475 Range on HMM: 1-19/33 Sequence Identity: 36% (7 aa) NGFTNLMLYAAIGDARSVS .||| |.|.. |... |. DGFTPLHLACRCGHTEVVK |
|||||||||
Ank | GL50803_88735.AA | Ank | 487-516 | 36 | 8e-06 | 25.24 | Pfam | 1-33 (33) | Show / Hide |
Range on Protein: 487-516 Range on HMM: 1-33/33 Sequence Identity: 36% (12 aa) MGYTALMLAASNGHLACVDLLLK---EARATDN .|.|.|.||...||. .| .||. . |.|. DGFTPLHLACRCGHTEVVKMLLQHGADVNAQDD |
|||||||||
Ank | GL50803_88735.AA | Ank | 517-538 | 40 | 6e-05 | 22.1 | Pfam | 1-22 (33) | Show / Hide |
Range on Protein: 517-538 Range on HMM: 1-22/33 Sequence Identity: 40% (9 aa) YGWTALMMAADSGHADCVRSLL .|.|.|..|. .||...|. || DGFTPLHLACRCGHTEVVKMLL |
|||||||||
Ank | GL50803_88735.AA | Ank | 548-580 | 39 | 2.8e-07 | 30.53 | Pfam | 1-33 (33) | Show / Hide |
Range on Protein: 548-580 Range on HMM: 1-33/33 Sequence Identity: 39% (13 aa) GNMTPLMFAAQEGHVECVRLLLEDKDNLNAFTD .|||. |.. ||.|.|..||. ..|| .| DGFTPLHLACRCGHTEVVKMLLQHGADVNAQDD |
|||||||||
Ank | GL50803_88735.AA | Ank | 587-607 | 42 | 0.0304 | 12.35 | Pfam | 1-21 (33) | Show / Hide |
Range on Protein: 587-607 Range on HMM: 1-21/33 Sequence Identity: 42% (9 aa) EGINALVMAAWSGHLECVKLL .| .| .|. .||.|.||.| DGFTPLHLACRCGHTEVVKML |