Gene GL50803_17299 (G.lamblia)
GL50803_17299
Sequence
Name | Sequence Type | Origin | Length | Description | Download |
---|---|---|---|---|---|
GL50803_17299.AA | Protein | None | 1182 | None | Fasta, JSON |
GL50803_17299.kin_dom | Protein Kinase Domain | None | 337 | None | Fasta, JSON |
Protein domains of GL50803_17299.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
---|---|---|---|---|---|---|---|---|---|
S_TKc | GL50803_17299.AA | S_TKc | 22-360 | 15 | 1.4e-10 | -21.6 | SMART | 1-231 (231) | Show / Hide |
Range on Protein: 22-360 Range on HMM: 1-231/231 Sequence Identity: 15% (57 aa) RDEVGLVGTG------LVRKKGLGLMTTILVVPLHQHPPEVQIKIAHAMRDCLNIT--NPYLASYVDVTHSMREAKLTIETEFFGR--GSLRKKIDSHFK . . ..| | ..|.|. | | ... |..| |.. . || .. .| . .|. . |.|.. |... . YEILRKIGKGAFGKVYKCRHKKTGRIVAIKIIK------------EHIRREIQILKKHHPNIVKLYDVFQD---DHLYMVMEYCDGDLGDLFDYIKKRGR HGLI--FPEAEIWNVVAHIAAGLAYLHSPLPLPGKKAGFLLHLGLSPDSLMVYSDAEYKLTAYSIRQLLFRPIPPAEYARIIGIESENARWYMAPELRRA ||| ||| ... ... |. .|.|.|| .| | |. ... . . |.. . .| ..| .||||||. HGLRFPFPE-HARFYMYQICCALEYCHS--------H-GIIHRDLKPENILLDE--HIKICDFGLARQL---------TTFCG-----TPWYMAPEVL-- FSRYGSLCQLST-KCDIWSLGILLLDMVS-LALYRDNTSDPSTELVKNDSTIPAVIILPNDDRPLRVKMDDLSEEHNNSTDDEDAKRVSTTSLSSSVDYH . .. |||.||.|..| |.. ... . . .... --------GYGKCKCDWWSCGCILYEMLCGYPPFP--QMQMMFKKIG----------------------------------------------------- GFCHPPRSLLKTLLDDGLDTPYSKELITLIKQCVSEDPSERPSATIICK-------LPSV |.|.. .|..| ||..||.| . . | . ----------------------SPEAKDFIRKCLQKDPEKRPTA-EALQDEWDIKCHPWF |
|||||||||
Kinase | GL50803_17299.AA | TKL | 201-352 | 14 | 3.1e-09 | 29.44 | In-house | 239-358 (364) | Show / Hide |
Range on Protein: 201-352 Range on HMM: 239-358/364 Sequence Identity: 14% (26 aa) YMAPELRRAFSRYGSLC---------QLSTKCDIWSLGILLLDMVSLALYRDNTSDPSTELVKNDSTIPAVIILPNDDRPLRVKMDDLSEEHNNSTDDED .||||. | | . . . |.|||..| ||.| ... . WMAPEVLRGQMNYTEKVGIDEFCKGFEYSEKCDVYSFGIVLWEILTRCR--------------------------------------------------- AKRVSTTSLSSSVDYHGFCHPPRSLL-------KTLLDDGLD----------------TPYSKELITLIKQCVSEDPSERPSAT |... ..|. . . |.|| .. .... |...| ..||..|||.. -------------PYYDYPYMPMIFQDPFEEMFMMVCDKGLRPPIPPIWQNHHKMCPCPDCPPSMKKLMQDCWDHDPEKRPSFQ |
|||||||||
Kinase | GL50803_17299.AA | NEK8 | 328-360 | 39 | 2.1e-07 | 17.04 | In-house | 246-278 (278) | Show / Hide |
Range on Protein: 328-360 Range on HMM: 246-278/278 Sequence Identity: 39% (13 aa) PYSKELITLIKQCVSEDPSERPSATIICKLPSV .||.|.. |. .| . || |||| | . | . HYSNEMRMLVHNCLQQDPEQRPSASQIMAMPLC |
|||||||||
Kinase | GL50803_17299.AA | NEK | 329-360 | 40 | 2.8e-07 | 22.13 | In-house | 255-286 (286) | Show / Hide |
Range on Protein: 329-360 Range on HMM: 255-286/286 Sequence Identity: 40% (13 aa) YSKELITLIKQCVSEDPSERPSATIICKLPSV ||..| || |. ||..|||.. | ..| . YSQDLQNLISQMLQKDPEQRPSCNQILEMPFI |
|||||||||
Kinase | GL50803_17299.AA | WEE | 89-137 | 29 | 1e-06 | 18.16 | In-house | 79-129 (297) | Show / Hide |
Range on Protein: 89-137 Range on HMM: 79-129/297 Sequence Identity: 29% (15 aa) KLTIETEFFGRGS--LRKKIDSHFKHGLIFPEAEIWNVVAHIAAGLAYLHS .. | .|. .|| | . | .. . . ..||..||.. .|. ||...|| HMYIQMEYCNGGSNLLQFWIQQCHNWNHWLPEWMIWQILVDICQGLHHIHS |
|||||||||
Kinase | GL50803_17299.AA | NEK1 | 329-360 | 37 | 1e-06 | 19.53 | In-house | 245-276 (276) | Show / Hide |
Range on Protein: 329-360 Range on HMM: 245-276/276 Sequence Identity: 37% (12 aa) YSKELITLIKQCVSEDPSERPSATIICKLPSV ||.|| |..| . .|. |||.. | . |.. YSYELQSLVSQMFKRNPRHRPSVNQILERPFI |
|||||||||
Kinase | GL50803_17299.AA | NAK | 326-358 | 24 | 1e-05 | 14.99 | In-house | 267-299 (299) | Show / Hide |
Range on Protein: 326-358 Range on HMM: 267-299/299 Sequence Identity: 24% (8 aa) DTPYSKELITLIKQCVSEDPSERPSATIICKLP .. ||.... ||. . .||..||. .... NSRYSQQMHDLIRYMLTPDPEQRPNIYQVLNQL |
|||||||||
Kinase | GL50803_17299.AA | TKL-ciliate1 | 329-357 | 26 | 4.1e-05 | 13.44 | In-house | 250-279 (279) | Show / Hide |
Range on Protein: 329-357 Range on HMM: 250-279/279 Sequence Identity: 26% (8 aa) YSKELITLIKQCVSEDPSERPSAT-IICKL .. ....|.. | ...| ||.. || | CPQNFHNLMMRCWCQNPNKRPNFNEIIQIL |
|||||||||
Kinase | GL50803_17299.AA | NAK-Unclassified | 329-350 | 50 | 7.9e-05 | 12.49 | In-house | 374-395 (405) | Show / Hide |
Range on Protein: 329-350 Range on HMM: 374-395/405 Sequence Identity: 50% (11 aa) YSKELITLIKQCVSEDPSERPS || |. ||| .. |||..||. YSNQLHNLIKIMLNEDPIQRPN |
|||||||||
Kinase | GL50803_17299.AA | Pkinase | 199-237 | 35 | 0.000102 | 17.77 | Pfam | 175-207 (293) | Show / Hide |
Range on Protein: 199-237 Range on HMM: 175-207/293 Sequence Identity: 35% (14 aa) RWYMAPELRRAFSRYGSLCQLSTKCDIWSLGILLLDMVS .||||||. | . ..|.|.||.|..| |.. PWYMAPEVIR------GGQYYGPKVDMWSCGCILYEMLC |
|||||||||
Kinase | GL50803_17299.AA | WEE | 325-360 | 33 | 0.0002 | 10.84 | In-house | 262-297 (297) | Show / Hide |
Range on Protein: 325-360 Range on HMM: 262-297/297 Sequence Identity: 33% (12 aa) LDTPYSKELITLIKQCVSEDPSERPSATIICKLPSV .| ..|.|| |||. .||. ||.. . . | . FDNIISQELKQLIKWMMHPDPEQRPTCQQLLQHPVL |
|||||||||
Kinase | GL50803_17299.AA | NEK | 99-137 | 32 | 0.000237 | 11.68 | In-house | 90-132 (286) | Show / Hide |
Range on Protein: 99-137 Range on HMM: 90-132/286 Sequence Identity: 32% (14 aa) R-GSLRKKIDS--HFKH-GLIFPEAEIWNVVAHIAAGLAYLHS . | | .|| | . |. | |.| .||.. .... .| |.|. GGGDLYQKIKSIKKQKQKGKYFEEEQIWDWFIQMCLALKYMHD |
|||||||||
Kinase | GL50803_17299.AA | STE | 201-236 | 38 | 0.000364 | 10.75 | In-house | 228-262 (359) | Show / Hide |
Range on Protein: 201-236 Range on HMM: 228-262/359 Sequence Identity: 38% (14 aa) YMAPELRRAFSRYGSLCQLSTKCDIWSLGILLLDMV .|||| . .. . . .|||||||||.... |. WMAPEVIQQNGQG-RDKGYDTKCDIWSLGCTIIEMA |
|||||||||
Kinase | GL50803_17299.AA | TKL-Unique | 336-357 | 56 | 0.000829 | 9.52 | In-house | 268-290 (290) | Show / Hide |
Range on Protein: 336-357 Range on HMM: 268-290/290 Sequence Identity: 56% (13 aa) LIKQCVSEDPSERPS-ATIICKL ||.|| |||.||| .|| .| LIQQCWHHDPSQRPSFDEIIHRL |
|||||||||
Kinase | GL50803_17299.AA | STE | 329-352 | 37 | 0.005468 | 6.54 | In-house | 326-349 (359) | Show / Hide |
Range on Protein: 329-352 Range on HMM: 326-349/359 Sequence Identity: 37% (9 aa) YSKELITLIKQCVSEDPSERPSAT .|.|.. |..| ||..||.|. WSPEFKDFINKCLQKDPNKRPTAS |
|||||||||
Kinase | GL50803_17299.AA | TKL-Unique | 201-232 | 45 | 0.005483 | 6.59 | In-house | 192-218 (290) | Show / Hide |
Range on Protein: 201-232 Range on HMM: 192-218/290 Sequence Identity: 45% (15 aa) YMAPELRRA-FSRYGSLCQLSTKCDIWSLGILL .||||. | | || |.|.|..| || | WMAPEVLRMNF------CQYSEKSDVYSFGIVL |
|||||||||
Kinase | GL50803_17299.AA | NAK-Unclassified | 217-232 | 50 | 0.006363 | 5.72 | In-house | 319-334 (405) | Show / Hide |
Range on Protein: 217-232 Range on HMM: 319-334/405 Sequence Identity: 50% (8 aa) CQLSTKCDIWSLGILL |... | |||.||..| CPIDEKIDIWALGCFL |
|||||||||
Kinase | GL50803_17299.AA | NAK | 217-232 | 50 | 0.006495 | 5.47 | In-house | 216-231 (299) | Show / Hide |
Range on Protein: 217-232 Range on HMM: 216-231/299 Sequence Identity: 50% (8 aa) CQLSTKCDIWSLGILL |. .| |||.||..| CPIDEKVDIWALGCML |
|||||||||
Kinase | GL50803_17299.AA | STE | 95-137 | 31 | 0.007259 | 6.1 | In-house | 117-170 (359) | Show / Hide |
Range on Protein: 95-137 Range on HMM: 117-170/359 Sequence Identity: 31% (17 aa) EFFGRGSLRKKIDSHFKHGL----------IFPEAEIWNVVAHIAAG-LAYLHS |. . |||.. |.. ...| ||| .| .. | | |.|||| EYMDGGSLDDIIKHKYGCGKPLNHNRQHQHRFPESQIAYICRQILKGLLYYLHS |
|||||||||
Kinase | GL50803_17299.AA | TKL-ciliate1 | 201-232 | 32 | 0.018588 | 4.22 | In-house | 180-209 (279) | Show / Hide |
Range on Protein: 201-232 Range on HMM: 180-209/279 Sequence Identity: 32% (11 aa) YMAPELRR--AFSRYGSLCQLSTKCDIWSLGILL .|||| . |. | . ..| ||...||.. WMAPEQMDPHIFPNY----PINEKIDIYAYGIVM |
|||||||||
Kinase | GL50803_17299.AA | TKL-Unique | 94-137 | 20 | 0.031064 | 3.9 | In-house | 79-128 (290) | Show / Hide |
Range on Protein: 94-137 Range on HMM: 79-128/290 Sequence Identity: 20% (10 aa) TEFFGRGSLRKKID------SHFKHGLIFPEAEIWNVVAHIAAGLAYLHS .|.. .|||.. .. . . .. . . . . || |. |||. MEYCPGGSLYDVLHQNNNNNNNNNNNCKLNMQQRVKMAIDIAQGMYYLHH |
|||||||||
Kinase | GL50803_17299.AA | NEK | 222-238 | 58 | 0.049454 | 3.42 | In-house | 204-220 (286) | Show / Hide |
Range on Protein: 222-238 Range on HMM: 204-220/286 Sequence Identity: 58% (10 aa) KCDIWSLGILLLDMVSL |.|||||| .| |..| KSDIWSLGCVLYEMCTL |
|||||||||
Kinase | GL50803_17299.AA | Pkinase | 330-360 | 38 | 0.087565 | 7.39 | Pfam | 263-293 (293) | Show / Hide |
Range on Protein: 330-360 Range on HMM: 263-293/293 Sequence Identity: 38% (12 aa) SKELITLIKQCVSEDPSERPSATIICKLPSV |.|.. .|| | ||..||.|. |.. | . SEECKDFIKWCLCKDPKKRPTAEQILQHPWF |
|||||||||
Kinase | GL50803_17299.AA | Pkinase | 116-137 | 40 | 1.124522 | 3.47 | Pfam | 105-126 (293) | Show / Hide |
Range on Protein: 116-137 Range on HMM: 105-126/293 Sequence Identity: 40% (9 aa) FPEAEIWNVVAHIAAGLAYLHS |.| |. ... |. ||.|.|| FSEWECKFYMYQILRGLEYCHS |
|||||||||
Ank | GL50803_17299.AA | Ank | 478-504 | 36 | 0.001447 | 17.12 | Pfam | 4-33 (33) | Show / Hide |
Range on Protein: 478-504 Range on HMM: 4-33/33 Sequence Identity: 36% (11 aa) TALMMAAREGNTECIKLLLA---EVGIVTA |.|..|.| |.||..|.|| .| ... TPLHLACRCGHTEVVKMLLQHGADVNAQDD |
|||||||||
Ank | GL50803_17299.AA | Ank | 505-526 | 31 | 0.002722 | 16.13 | Pfam | 1-22 (33) | Show / Hide |
Range on Protein: 505-526 Range on HMM: 1-22/33 Sequence Identity: 31% (7 aa) KGETALMYAAQNGCLAATQLLL |.|.|..|...|.. ..|| DGFTPLHLACRCGHTEVVKMLL |
|||||||||
Ank | GL50803_17299.AA | Ank | 535-555 | 33 | 0.001844 | 16.74 | Pfam | 1-21 (33) | Show / Hide |
Range on Protein: 535-555 Range on HMM: 1-21/33 Sequence Identity: 33% (7 aa) YGETALMYAVQNGFVHIVNLL .|.|.|..|...| . .| .| DGFTPLHLACRCGHTEVVKML |
|||||||||
Ank | GL50803_17299.AA | Ank | 566-591 | 42 | 0.003651 | 15.67 | Pfam | 1-26 (33) | Show / Hide |
Range on Protein: 566-591 Range on HMM: 1-26/33 Sequence Identity: 42% (11 aa) DGLTALMLAAKLGRGRCVAILMHHEA || |.|.||.. |. ..| |. | | DGFTPLHLACRCGHTEVVKMLLQHGA |
|||||||||
Ank | GL50803_17299.AA | Ank | 597-620 | 33 | 6.822392 | 3.87 | Pfam | 1-24 (33) | Show / Hide |
Range on Protein: 597-620 Range on HMM: 1-24/33 Sequence Identity: 33% (8 aa) LGETALELALKYRHGHCADLLLDY |.|.| || .. | .. .||.. DGFTPLHLACRCGHTEVVKMLLQH |
|||||||||
Ank | GL50803_17299.AA | Ank | 628-650 | 39 | 8.584585 | 3.51 | Pfam | 1-23 (33) | Show / Hide |
Range on Protein: 628-650 Range on HMM: 1-23/33 Sequence Identity: 39% (9 aa) NGASPLRFAVDNGAIKVVPRLLY .| .|| |. .| ..|| ||. DGFTPLHLACRCGHTEVVKMLLQ |
|||||||||
Ank | GL50803_17299.AA | Ank | 835-860 | 34 | 0.012279 | 13.77 | Pfam | 1-25 (33) | Show / Hide |
Range on Protein: 835-860 Range on HMM: 1-25/33 Sequence Identity: 34% (9 aa) GNDTALLLAAKNHHFDCIKLLLCEQG .|.| ||... | ...|.|| .| DGFTPLHLACRCGHTEVVKMLLQ-HG |
|||||||||
Ank | GL50803_17299.AA | Ank | 865-886 | 36 | 0.473252 | 8.05 | Pfam | 1-22 (33) | Show / Hide |
Range on Protein: 865-886 Range on HMM: 1-22/33 Sequence Identity: 36% (8 aa) DCVTALMVTACKGDVESLKLLL | |.|.. ...|..| .|.|| DGFTPLHLACRCGHTEVVKMLL |
|||||||||
Ank | GL50803_17299.AA | Ank | 895-918 | 37 | 6.8e-05 | 21.9 | Pfam | 1-24 (33) | Show / Hide |
Range on Protein: 895-918 Range on HMM: 1-24/33 Sequence Identity: 37% (9 aa) DGNSALMLAAEAGHDACVQLLIKR ||...|.||.. || .|..|... DGFTPLHLACRCGHTEVVKMLLQH |
|||||||||
Ank | GL50803_17299.AA | Ank | 926-946 | 28 | 1.643366 | 6.1 | Pfam | 1-21 (33) | Show / Hide |
Range on Protein: 926-946 Range on HMM: 1-21/33 Sequence Identity: 28% (6 aa) AGRTALIRAAEACNLSTVNLL |.|.| |.. ... | .| DGFTPLHLACRCGHTEVVKML |
|||||||||
Ank | GL50803_17299.AA | Ank | 983-1008 | 42 | 1.4e-05 | 24.37 | Pfam | 1-25 (33) | Show / Hide |
Range on Protein: 983-1008 Range on HMM: 1-25/33 Sequence Identity: 42% (11 aa) CGWTALMFAAKAGHVKCVELLLQEAG .|.|.|. |.. ||...|..||| .| DGFTPLHLACRCGHTEVVKMLLQ-HG |
|||||||||
Ank | GL50803_17299.AA | Ank | 1013-1039 | 33 | 0.021673 | 12.88 | Pfam | 1-26 (33) | Show / Hide |
Range on Protein: 1013-1039 Range on HMM: 1-26/33 Sequence Identity: 33% (9 aa) DERTAIFMAAKQGHKECIELLFDKEGA | .|. .|.. ||.|....| . || DGFTPLHLACRCGHTEVVKMLLQ-HGA |
|||||||||
Ank | GL50803_17299.AA | Ank | 1044-1061 | 44 | 0.278591 | 8.88 | Pfam | 1-18 (33) | Show / Hide |
Range on Protein: 1044-1061 Range on HMM: 1-18/33 Sequence Identity: 44% (8 aa) DGWTILMATAYGGHAECV ||.| |. .. ||.|.| DGFTPLHLACRCGHTEVV |
|||||||||
Ank | GL50803_17299.AA | Ank | 1089-1114 | 50 | 8.7e-07 | 28.73 | Pfam | 1-26 (33) | Show / Hide |
Range on Protein: 1089-1114 Range on HMM: 1-26/33 Sequence Identity: 50% (13 aa) DGRTALMLAADQGHAQCVKLLLEKEA ||.|.|.||. ||...||.||.. | DGFTPLHLACRCGHTEVVKMLLQHGA |
|||||||||
Ank | GL50803_17299.AA | Ank | 1120-1152 | 24 | 0.07623 | 10.91 | Pfam | 1-33 (33) | Show / Hide |
Range on Protein: 1120-1152 Range on HMM: 1-33/33 Sequence Identity: 24% (8 aa) LGESALFKAVRWEHPDCVTLLAPYEAQLTNKNN |...| |.|. |...|..| . | . ... DGFTPLHLACRCGHTEVVKMLLQHGADVNAQDD |