Gene 82114.m00022 (T.vaginalis)

82114.m00022

Species: T.vaginalis
Alias: 82114.m00022, TvagK0986
External Links:
Annotation:

Classification

Group: PKL
Family: CAK
Subfamily: CAK-Unclassified

Sequence

Name Sequence Type Origin Length Description Download
82114.m00022.AA Protein None 359 None Fasta, JSON
82114.m00022.kin_dom Protein Kinase Domain None 282 None Fasta, JSON

Protein domain

Protein domains of 82114.m00022.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
APH 82114.m00022.AA APH 19-47 31 0.08606 6.99 Pfam 1-27 (248) Show / Hide 
Range on Protein: 19-47
Range on HMM: 1-27/248
Sequence Identity: 31% (9 aa)

EVVPFGAGLINTTYRVVNTDSNCPDYILQ
...|...|  | ||.....|   |.|.|.
WWRPISGGWSNRTYYRTTDDR--PRYVLR
APH 82114.m00022.AA APH 150-277 15 2.1e-12 43.16 Pfam 116-248 (248) Show / Hide 
Range on Protein: 150-277
Range on HMM: 116-248/248
Sequence Identity: 15% (22 aa)

ESIPLFHNMEFRLQQLRDAVKENKAGRLDEVKYY--VDELEKRADEMCKAEKLHREGKLPKRVCHCDTKVNNILFD---EDGSVLCVIDLDTVMSSYIFS
.  |...  ..|| ..|. ... ....  |..    . .|..|. ....|.        | ..||.| . .|...|   ..| |  |||.|...   .  
PDCPFAWWGRWRLYHWRQLMDWCRCWVDPEWFDEDRQWWLWQRLWAWLEAHWP------PPCWCHGDFHPGNVMWDPRPDGGRVTGVIDWDDACWGDPHY

DVGDFL-R-YAANTGAEDDKNLDNVN----FNMEIFKAF
|.. .. . . .. ..| .. .        ....  ...
DLAMCWWHWWCRWFWPEWRDAYGRAYCRHDPDWHRMRWW